(data stored in ACNUC7421 zone)

EMBL: CP001402.PE438

CP001402.PE438       Location/Qualifiers
FT   CDS             complement(378372..379271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0444"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41074"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV1"
FT                   /protein_id="ACR41074.1"
FT                   /translation="MDESEIEKLYNGKLSDLYYLYSHATAEEIIKWMKNRKTAEIKIHE
FT                   IEGDSEVVVVIPTANVNGKLARNAKEVYKGFHIIFVESSGPLFNYARSVNLGVKHSLVL
FT                   KPKWVIISNDDVISIRGNIKEELSTVSINVDLIMASRSNYHTYPVVLVKPNDYFIKGMK
FT                   IFGMVFNLAPADVYGEILRYKERLGIKSITMIKSMVGFMVKFSGEIVGEFINSGSFAIV
FT                   RPREKVMDETFINSHEDLLLSITSKYYISKIKVREMRGASLGFGKLRFAKIFVNEIYFN
FT                   YLIRARVLKLNDKQLYSD"
     MDESEIEKLY NGKLSDLYYL YSHATAEEII KWMKNRKTAE IKIHEIEGDS EVVVVIPTAN        60
     VNGKLARNAK EVYKGFHIIF VESSGPLFNY ARSVNLGVKH SLVLKPKWVI ISNDDVISIR       120
     GNIKEELSTV SINVDLIMAS RSNYHTYPVV LVKPNDYFIK GMKIFGMVFN LAPADVYGEI       180
     LRYKERLGIK SITMIKSMVG FMVKFSGEIV GEFINSGSFA IVRPREKVMD ETFINSHEDL       240
     LLSITSKYYI SKIKVREMRG ASLGFGKLRF AKIFVNEIYF NYLIRARVLK LNDKQLYSD        299
//

If you have problems or comments...

PBIL Back to PBIL home page