(data stored in ACNUC7421 zone)

EMBL: CP001402.PE439

CP001402.PE439       Location/Qualifiers
FT   CDS             complement(379253..379933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41075"
FT                   /db_xref="GOA:C4KDV2"
FT                   /db_xref="InterPro:IPR017825"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV2"
FT                   /protein_id="ACR41075.1"
FT                   /translation="MEIFKPDYTMIDSMIFFPALILSLFVRRNYFQLLKSIAIVSPLYL
FT                   FWDFLATWKDSWSFNPKYVMGIYVINLPMEEVMFFLVTPFATLLIFDFVMNSVRDREVK
FT                   WVQKVIITTIPLLIITLPFVFNYSYTFIDFLYLIMSFIISLLIARDLLVSRNFWIFIGL
FT                   SYIPFLLFDYFLTSDPVVIYGPNSILGIRFITIPVEDFIYSFSMLTLYTVFYTRGNKLW
FT                   MKAR"
     MEIFKPDYTM IDSMIFFPAL ILSLFVRRNY FQLLKSIAIV SPLYLFWDFL ATWKDSWSFN        60
     PKYVMGIYVI NLPMEEVMFF LVTPFATLLI FDFVMNSVRD REVKWVQKVI ITTIPLLIIT       120
     LPFVFNYSYT FIDFLYLIMS FIISLLIARD LLVSRNFWIF IGLSYIPFLL FDYFLTSDPV       180
     VIYGPNSILG IRFITIPVED FIYSFSMLTL YTVFYTRGNK LWMKAR                      226
//

If you have problems or comments...

PBIL Back to PBIL home page