(data stored in ACNUC7421 zone)

EMBL: CP001402.PE445

CP001402.PE445       Location/Qualifiers
FT   CDS             384819..385232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0451"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41081"
FT                   /db_xref="GOA:C4KDV8"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV8"
FT                   /protein_id="ACR41081.1"
FT                   /translation="MLDASTRGQILEFILNDRNQRSTAYLFITHDISIASYVSDRIGVM
FT                   YLGKLVEIGSPEEVISEPLHPYTQALLQAVPVPDPDVGVREPNIKGEIQNPLELPKGCV
FT                   FYNRCPFAKDICKEKPPEIKRIKGDHYVACHLY"
     MLDASTRGQI LEFILNDRNQ RSTAYLFITH DISIASYVSD RIGVMYLGKL VEIGSPEEVI        60
     SEPLHPYTQA LLQAVPVPDP DVGVREPNIK GEIQNPLELP KGCVFYNRCP FAKDICKEKP       120
     PEIKRIKGDH YVACHLY                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page