(data stored in ACNUC7421 zone)

EMBL: CP001402.PE446

CP001402.PE446       Location/Qualifiers
FT   CDS             385210..385605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0452"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41082"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDV9"
FT                   /protein_id="ACR41082.1"
FT                   /translation="MSHAIYTNLTFSLHFSLLFFSLTFSSTQLLGYHGIFSSLSINLNV
FT                   EVSVKNLSYGGYNITIKESGSSYNIILGIKVNYNGGYYYIVNATNKEILITYYLSNSSN
FT                   IGLLAPLYIPHLTNGTFTFNEKNSKFK"
     MSHAIYTNLT FSLHFSLLFF SLTFSSTQLL GYHGIFSSLS INLNVEVSVK NLSYGGYNIT        60
     IKESGSSYNI ILGIKVNYNG GYYYIVNATN KEILITYYLS NSSNIGLLAP LYIPHLTNGT       120
     FTFNEKNSKF K                                                            131
//

If you have problems or comments...

PBIL Back to PBIL home page