(data stored in ACNUC7421 zone)

EMBL: CP001402.PE448

CP001402.PE448       Location/Qualifiers
FT   CDS             386947..387135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41084"
FT                   /db_xref="GOA:C4KDW1"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW1"
FT                   /protein_id="ACR41084.1"
FT                   /translation="MNNFVSQMQSNYTNSGQIYLYTDISLVKNETNSASLIIPIIVVIV
FT                   IVATSGVGVYKLRKSSR"
     MNNFVSQMQS NYTNSGQIYL YTDISLVKNE TNSASLIIPI IVVIVIVATS GVGVYKLRKS        60
     SR                                                                       62
//

If you have problems or comments...

PBIL Back to PBIL home page