(data stored in ACNUC7421 zone)

EMBL: CP001402.PE449

CP001402.PE449       Location/Qualifiers
FT   CDS             complement(387301..387480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41085"
FT                   /db_xref="GOA:C4KDW2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW2"
FT                   /protein_id="ACR41085.1"
FT                   /translation="MRSILKIMVGLAMLSGAIGLDYIGASFQSLSVLVVSMILAIAGTM
FT                   VGIRGLMEFLGERF"
     MRSILKIMVG LAMLSGAIGL DYIGASFQSL SVLVVSMILA IAGTMVGIRG LMEFLGERF         59
//

If you have problems or comments...

PBIL Back to PBIL home page