(data stored in ACNUC7421 zone)

EMBL: CP001402.PE450

CP001402.PE450       Location/Qualifiers
FT   CDS             complement(387496..388473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0456"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41086"
FT                   /db_xref="GOA:C4KDW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW3"
FT                   /protein_id="ACR41086.1"
FT                   /translation="MVMRLHVGSISDYIVKVENLKVYFTKGGIFSKKYIVKALDNVTLS
FT                   IKEKEVMGVVGESGSGKTTLGRVTIGLQKPTAGDIYIRVDKREINVNKTKLKDISKYVQ
FT                   MIYQDPYSSIDPIMRVYDVLAMPLKYKKEIDIDGKIEEAMRLVDLPLELLENRVYQLSG
FT                   GQRQRLSIARAIVVNPKYIVADEPTTMLDASLKGEILKIIKDARESKGFSFMLITHELP
FT                   IAKIISDRIAVLYLGKVVELGSSNEIIKNPLHPYTQGLIEVYPRIDPSLRDKMKEIKIK
FT                   VDIVRPEKGCVFYPRCPFAMSKCKEQEPELKEISPGHYVACWLY"
     MVMRLHVGSI SDYIVKVENL KVYFTKGGIF SKKYIVKALD NVTLSIKEKE VMGVVGESGS        60
     GKTTLGRVTI GLQKPTAGDI YIRVDKREIN VNKTKLKDIS KYVQMIYQDP YSSIDPIMRV       120
     YDVLAMPLKY KKEIDIDGKI EEAMRLVDLP LELLENRVYQ LSGGQRQRLS IARAIVVNPK       180
     YIVADEPTTM LDASLKGEIL KIIKDARESK GFSFMLITHE LPIAKIISDR IAVLYLGKVV       240
     ELGSSNEIIK NPLHPYTQGL IEVYPRIDPS LRDKMKEIKI KVDIVRPEKG CVFYPRCPFA       300
     MSKCKEQEPE LKEISPGHYV ACWLY                                             325
//

If you have problems or comments...

PBIL Back to PBIL home page