(data stored in ACNUC7421 zone)

EMBL: CP001402.PE451

CP001402.PE451       Location/Qualifiers
FT   CDS             complement(388442..389380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0457"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41087"
FT                   /db_xref="GOA:C4KDW4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW4"
FT                   /protein_id="ACR41087.1"
FT                   /translation="MLLEVRNLKVYFYTKRGIVKAVDDVNLYLDKGEIIGLAGESGSGK
FT                   STIGYAIMRLVPFPGKIEGGEILFKGENILKLDEETFRKNYRWKKIAMVFQGSMSGFTP
FT                   VFKIRDQIIEVLRIHGWTGDYDKRVEELFKMVNMDPQLAEKYPHELSGGQKQRAFIAMA
FT                   LALNPEILIADEPTTALDVMVQEHILNLLKKLRKELNLSIIFITHDLALLSEISDRDYM
FT                   LYAGKVMESGPSEVIFKKPRHPYTSLLVESIATLDKDIIKGIPGSMPDLSNPPVGCRFN
FT                   SRCPFARDICFKEEPKMKAFSDGDEVACWLY"
     MLLEVRNLKV YFYTKRGIVK AVDDVNLYLD KGEIIGLAGE SGSGKSTIGY AIMRLVPFPG        60
     KIEGGEILFK GENILKLDEE TFRKNYRWKK IAMVFQGSMS GFTPVFKIRD QIIEVLRIHG       120
     WTGDYDKRVE ELFKMVNMDP QLAEKYPHEL SGGQKQRAFI AMALALNPEI LIADEPTTAL       180
     DVMVQEHILN LLKKLRKELN LSIIFITHDL ALLSEISDRD YMLYAGKVME SGPSEVIFKK       240
     PRHPYTSLLV ESIATLDKDI IKGIPGSMPD LSNPPVGCRF NSRCPFARDI CFKEEPKMKA       300
     FSDGDEVACW LY                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page