(data stored in ACNUC7421 zone)

EMBL: CP001402.PE452

CP001402.PE452       Location/Qualifiers
FT   CDS             complement(389382..390734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0458"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41088"
FT                   /db_xref="GOA:C4KDW5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW5"
FT                   /protein_id="ACR41088.1"
FT                   /translation="MSKRNVGFSSYLRDFLSSKIGLVGLIILIILLIFTGIAISIPAKV
FT                   YASWNNPASWNQYPEHVPPAWLSIFYPNKYFTTEELSPINMSLYSPAKNIFVAIITYQF
FT                   NWSKVLPAYNVYFIVSTNITPIEEVIYWSKPDGYTLQVNVPNGVFNVPFDLTSIRGDIL
FT                   NYISSITGKTPNIVNSTVLSSALFNSPKSNFTTTEQGRYVVKIEIVSSSPMNITKSGLL
FT                   LLGNSYGLMGTDYFGRPLDLGVLLGLPNALEIGALTSLVAVLVGIFVGGISGYLGGNKD
FT                   SGIQWLTLVFLALPALPFLVAVSFVTEPNLEIEALLIAFLSWPFYAIIARSMALSIKSN
FT                   SFVEADKLLGIPSYRVFFTHFMPRLIPITVAYMALGVPAGILLAQTLAFLGIAPANIVT
FT                   WGGILDAAETYQAQVNGWWWWVVFPGAMIVIVAIPFVLIGFAIERVTLGER"
     MSKRNVGFSS YLRDFLSSKI GLVGLIILII LLIFTGIAIS IPAKVYASWN NPASWNQYPE        60
     HVPPAWLSIF YPNKYFTTEE LSPINMSLYS PAKNIFVAII TYQFNWSKVL PAYNVYFIVS       120
     TNITPIEEVI YWSKPDGYTL QVNVPNGVFN VPFDLTSIRG DILNYISSIT GKTPNIVNST       180
     VLSSALFNSP KSNFTTTEQG RYVVKIEIVS SSPMNITKSG LLLLGNSYGL MGTDYFGRPL       240
     DLGVLLGLPN ALEIGALTSL VAVLVGIFVG GISGYLGGNK DSGIQWLTLV FLALPALPFL       300
     VAVSFVTEPN LEIEALLIAF LSWPFYAIIA RSMALSIKSN SFVEADKLLG IPSYRVFFTH       360
     FMPRLIPITV AYMALGVPAG ILLAQTLAFL GIAPANIVTW GGILDAAETY QAQVNGWWWW       420
     VVFPGAMIVI VAIPFVLIGF AIERVTLGER                                        450
//

If you have problems or comments...

PBIL Back to PBIL home page