(data stored in ACNUC7421 zone)

EMBL: CP001402.PE453

CP001402.PE453       Location/Qualifiers
FT   CDS             complement(390737..391783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0459"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41089"
FT                   /db_xref="GOA:C4KDW6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW6"
FT                   /protein_id="ACR41089.1"
FT                   /translation="MGFTTYMIKKVLIYFSVLLATLTILYIFTFPILQEVIAKSINFQV
FT                   AQFSQTLFKNAHNLNSTQIQIAVEKYRESLIAAYGLNQPIIDKYFIQMYNLMRFDFGTA
FT                   YFLQAPSGSREVSSIIAYYLPNTILLFTTATIVFIVAGTIIGLLSAKSKFWEKVIAIIA
FT                   VIHSSIPTWWLGFVLIAALAYAVKVFPPGGMTSVPPPKNPFDYGISVLYHMSLPLITIF
FT                   IVNVGGFAYIVRSLVTSIMKEDFVITAKARGLPDSRILYRHVLRSASPSIATQAILALA
FT                   GSLGGSLTTEVVFEWPGVGLLTYVAITLNDLPVILGITYVLTIVLLLGLFLGELVYGLL
FT                   DPRIKVGE"
     MGFTTYMIKK VLIYFSVLLA TLTILYIFTF PILQEVIAKS INFQVAQFSQ TLFKNAHNLN        60
     STQIQIAVEK YRESLIAAYG LNQPIIDKYF IQMYNLMRFD FGTAYFLQAP SGSREVSSII       120
     AYYLPNTILL FTTATIVFIV AGTIIGLLSA KSKFWEKVIA IIAVIHSSIP TWWLGFVLIA       180
     ALAYAVKVFP PGGMTSVPPP KNPFDYGISV LYHMSLPLIT IFIVNVGGFA YIVRSLVTSI       240
     MKEDFVITAK ARGLPDSRIL YRHVLRSASP SIATQAILAL AGSLGGSLTT EVVFEWPGVG       300
     LLTYVAITLN DLPVILGITY VLTIVLLLGL FLGELVYGLL DPRIKVGE                    348
//

If you have problems or comments...

PBIL Back to PBIL home page