(data stored in ACNUC7421 zone)

EMBL: CP001402.PE454

CP001402.PE454       Location/Qualifiers
FT   CDS             complement(391801..394467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41090"
FT                   /db_xref="GOA:C4KDW7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW7"
FT                   /protein_id="ACR41090.1"
FT                   /translation="MYSVLSIKDKKIISLLILVATAISPIFAIAQSASSSPASTAITII
FT                   SYNGNDANGILAFEHGQIAFYAYAVPPSEYTSLPPGAKAYLLPSTYYDILVNPLNTTFG
FT                   FNPFQFQEVRFALNYIVNRTYFVDSILHGYGIPTISLYAGEPDVIHLQQTLSKYANVHY
FT                   NFTYANETIYKVLTAHGAKYINGQWYYNGKPITVYVFVRTDATVRREYAQYFITQLQKL
FT                   GFTVQQIQGNLQKEISVVYGSDPANTTWNILVEAWGGTYGYYDSGLAVGLYSTLGASDP
FT                   FSSYYGLSMGTYNDTKYESSLLLKEANELDNLSLIISQSQFTSAQEYYQIYNKIVELGI
FT                   NMSVRIGLGMSLTPIYALSNINGVYPSFAQSTLLSFQTYYSITNGSYPNVTIGVRYLSQ
FT                   GSANPGAGFTDAYTDEIGNALFTPSSLTVPGSGYPVPFIYTYKIVNITPHAVVSVPSNA
FT                   LWWNPTTQQITKVSPNTTAQMAVIYNLAPLFNNDKWADGQNITLADIIYEYIVASEMSL
FT                   NSSNPIYDSTASSVYAPALQTIKGFKIINSTAIEIWGNDWFFDPTEAVVSLFGSFNPLG
FT                   YALAGGGYFPWQMYVGMKDVVAQGKAAWSEGAAQSKGIDWLNLVSPTDIGYITSALQNA
FT                   SATGYIPKSLQIVENLSGITLVTPQEAKAGYEAAINFMKTYGNGLIGDGPYILVAWNPS
FT                   ASPPYAKLIRNPYFHLVPPSNALALPTMYSVSLSIPSTVSLGQTLTGTVMGTPAGSTTA
FT                   IPTPNAVVNIELLYPNGSIISGYQLMTNSSGQFTFTVPSSLSPGSYLLSVSAYSNTSIL
FT                   INPVTYTLVVLPSITTTTSTTTSTTTTTSVSTSLSTTTITSVSTVVSSASNIGYIAVIV
FT                   VLIIIIIALAVLLFRRR"
     MYSVLSIKDK KIISLLILVA TAISPIFAIA QSASSSPAST AITIISYNGN DANGILAFEH        60
     GQIAFYAYAV PPSEYTSLPP GAKAYLLPST YYDILVNPLN TTFGFNPFQF QEVRFALNYI       120
     VNRTYFVDSI LHGYGIPTIS LYAGEPDVIH LQQTLSKYAN VHYNFTYANE TIYKVLTAHG       180
     AKYINGQWYY NGKPITVYVF VRTDATVRRE YAQYFITQLQ KLGFTVQQIQ GNLQKEISVV       240
     YGSDPANTTW NILVEAWGGT YGYYDSGLAV GLYSTLGASD PFSSYYGLSM GTYNDTKYES       300
     SLLLKEANEL DNLSLIISQS QFTSAQEYYQ IYNKIVELGI NMSVRIGLGM SLTPIYALSN       360
     INGVYPSFAQ STLLSFQTYY SITNGSYPNV TIGVRYLSQG SANPGAGFTD AYTDEIGNAL       420
     FTPSSLTVPG SGYPVPFIYT YKIVNITPHA VVSVPSNALW WNPTTQQITK VSPNTTAQMA       480
     VIYNLAPLFN NDKWADGQNI TLADIIYEYI VASEMSLNSS NPIYDSTASS VYAPALQTIK       540
     GFKIINSTAI EIWGNDWFFD PTEAVVSLFG SFNPLGYALA GGGYFPWQMY VGMKDVVAQG       600
     KAAWSEGAAQ SKGIDWLNLV SPTDIGYITS ALQNASATGY IPKSLQIVEN LSGITLVTPQ       660
     EAKAGYEAAI NFMKTYGNGL IGDGPYILVA WNPSASPPYA KLIRNPYFHL VPPSNALALP       720
     TMYSVSLSIP STVSLGQTLT GTVMGTPAGS TTAIPTPNAV VNIELLYPNG SIISGYQLMT       780
     NSSGQFTFTV PSSLSPGSYL LSVSAYSNTS ILINPVTYTL VVLPSITTTT STTTSTTTTT       840
     SVSTSLSTTT ITSVSTVVSS ASNIGYIAVI VVLIIIIIAL AVLLFRRR                    888
//

If you have problems or comments...

PBIL Back to PBIL home page