(data stored in ACNUC7421 zone)

EMBL: CP001402.PE455

CP001402.PE455       Location/Qualifiers
FT   CDS             complement(394528..395535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0461"
FT                   /product="protein of unknown function DUF871"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41091"
FT                   /db_xref="GOA:C4KDW8"
FT                   /db_xref="InterPro:IPR008589"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDW8"
FT                   /protein_id="ACR41091.1"
FT                   /translation="MTKRRIGFSIFPGWKEIKDEQISLLKNVRDLGFSEIFMGIGPGTH
FT                   WRTPVNEALSVAKEILKEANKLHYYAFVDINPQILKELNASPRNLSMFMEIGFKGVRAD
FT                   YGFSKEEIVEMSKQMTVELNPFEISEEEVDFIARNSNLERIKACHNYYPVLYSGISKEI
FT                   FIEKNRIFKERGIEIGAFISNPKFNLRTTLEVLRYVEPFDSANYLFKFVDRVLIGDPIP
FT                   DYESLRQVSEVFKSDITKIRIKVYDESVGKRLDKKFAVENYREFAIVCYTRDNIYEGET
FT                   CYTKLFKNAVAVRGREVWIFTSDLGIGPYRLVGEIDDINMEIVKMSSEIMLISK"
     MTKRRIGFSI FPGWKEIKDE QISLLKNVRD LGFSEIFMGI GPGTHWRTPV NEALSVAKEI        60
     LKEANKLHYY AFVDINPQIL KELNASPRNL SMFMEIGFKG VRADYGFSKE EIVEMSKQMT       120
     VELNPFEISE EEVDFIARNS NLERIKACHN YYPVLYSGIS KEIFIEKNRI FKERGIEIGA       180
     FISNPKFNLR TTLEVLRYVE PFDSANYLFK FVDRVLIGDP IPDYESLRQV SEVFKSDITK       240
     IRIKVYDESV GKRLDKKFAV ENYREFAIVC YTRDNIYEGE TCYTKLFKNA VAVRGREVWI       300
     FTSDLGIGPY RLVGEIDDIN MEIVKMSSEI MLISK                                  335
//

If you have problems or comments...

PBIL Back to PBIL home page