(data stored in ACNUC7421 zone)

EMBL: CP001402.PE457

CP001402.PE457       Location/Qualifiers
FT   CDS             396026..397411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0463"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41093"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX0"
FT                   /protein_id="ACR41093.1"
FT                   /translation="MIGKVLELLNCKETEREINRRKFSVCDDVNFILNLPIGYLKDVIS
FT                   PLENYLSKHMTNNFSRLTRVVPNDYEDTQLHFSKFFLNLYSSAISEIPRFNILTSLVIL
FT                   DEYRMMPDKALIAAADELARNGINAIFSTSTPSVFFEEEIVSRFRNRRVVSISIVNEYG
FT                   QAVEGRDCVKKGEGYYQCRGSYEVIELIEDFNIRDLDYEIIKGVEVFKVKEPFTLFVNS
FT                   WEKALRLYRKLREERNTEVCLLNSSDECKVTITPKIMPTRFNVVSEISSLPTIVARSGI
FT                   INDRDKIYVWVDRDNYDTVTESTLNLLSNIKVCLKHPFGCNGKMGYANKTVLKPNIDER
FT                   LIKRLSEISHLMDRREFEKVTELFSDFVTVDLFTDKEKITTVPPEFVYENKKKILYYGN
FT                   NCVYTYFTDGEKCSKIVYNWLEGGGVSWLKRNLARAYKNYVEEEGKKEVFLGLKAKDVG
FT                   EWI"
     MIGKVLELLN CKETEREINR RKFSVCDDVN FILNLPIGYL KDVISPLENY LSKHMTNNFS        60
     RLTRVVPNDY EDTQLHFSKF FLNLYSSAIS EIPRFNILTS LVILDEYRMM PDKALIAAAD       120
     ELARNGINAI FSTSTPSVFF EEEIVSRFRN RRVVSISIVN EYGQAVEGRD CVKKGEGYYQ       180
     CRGSYEVIEL IEDFNIRDLD YEIIKGVEVF KVKEPFTLFV NSWEKALRLY RKLREERNTE       240
     VCLLNSSDEC KVTITPKIMP TRFNVVSEIS SLPTIVARSG IINDRDKIYV WVDRDNYDTV       300
     TESTLNLLSN IKVCLKHPFG CNGKMGYANK TVLKPNIDER LIKRLSEISH LMDRREFEKV       360
     TELFSDFVTV DLFTDKEKIT TVPPEFVYEN KKKILYYGNN CVYTYFTDGE KCSKIVYNWL       420
     EGGGVSWLKR NLARAYKNYV EEEGKKEVFL GLKAKDVGEW I                           461
//

If you have problems or comments...

PBIL Back to PBIL home page