(data stored in ACNUC7421 zone)

EMBL: CP001402.PE461

CP001402.PE461       Location/Qualifiers
FT   CDS             400544..401281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0467"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41097"
FT                   /db_xref="GOA:C4KDX4"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX4"
FT                   /protein_id="ACR41097.1"
FT                   /translation="MMRSRSFQIFRVIFKERYRQPTLELVIPTMLVSNIFITAFYARGL
FT                   FNTYGLVLAFIPLISVSETLAFALALRNIIFVTGDHIYRGSIISFIMIPIKRISLFFFT
FT                   YFCDIVLPYLFWLFTTELYILLSGIPVPQYLILVYTVCYFFTENIILLTALSFKSGGIV
FT                   TLLSGTILGILFIFGGIAGYYGIMTNSPLTPIATISNPYVFLIYEAISQKQVTYLNVGI
FT                   YSEVIISLILFFVSLQKFRIMEV"
     MMRSRSFQIF RVIFKERYRQ PTLELVIPTM LVSNIFITAF YARGLFNTYG LVLAFIPLIS        60
     VSETLAFALA LRNIIFVTGD HIYRGSIISF IMIPIKRISL FFFTYFCDIV LPYLFWLFTT       120
     ELYILLSGIP VPQYLILVYT VCYFFTENII LLTALSFKSG GIVTLLSGTI LGILFIFGGI       180
     AGYYGIMTNS PLTPIATISN PYVFLIYEAI SQKQVTYLNV GIYSEVIISL ILFFVSLQKF       240
     RIMEV                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page