(data stored in ACNUC7421 zone)

EMBL: CP001402.PE462

CP001402.PE462       Location/Qualifiers
FT   CDS             401286..401834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0468"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41098"
FT                   /db_xref="GOA:C4KDX5"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX5"
FT                   /protein_id="ACR41098.1"
FT                   /translation="MKFGLLTTIGLSLLVLSLLSINSPIHSYVSISNPYSIKIPNIAYV
FT                   NARLLENNSNVTVYAKLVHNGNVENIVKLPYYLELTPGIWEFSIYNETFPITLTKVINA
FT                   TVVNKSNGIVYVYEYQKIEKYQEIVTTKNATYPIALEVTIYKVNILQYKTIAEILGVLL
FT                   LFIDIILLAFRFIRDNHKL"
     MKFGLLTTIG LSLLVLSLLS INSPIHSYVS ISNPYSIKIP NIAYVNARLL ENNSNVTVYA        60
     KLVHNGNVEN IVKLPYYLEL TPGIWEFSIY NETFPITLTK VINATVVNKS NGIVYVYEYQ       120
     KIEKYQEIVT TKNATYPIAL EVTIYKVNIL QYKTIAEILG VLLLFIDIIL LAFRFIRDNH       180
     KL                                                                      182
//

If you have problems or comments...

PBIL Back to PBIL home page