(data stored in ACNUC7421 zone)

EMBL: CP001402.PE465

CP001402.PE465       Location/Qualifiers
FT   CDS             403420..403722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0471"
FT                   /product="SAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41101"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX8"
FT                   /protein_id="ACR41101.1"
FT                   /translation="MPHFLIHNKNDNVGVAITDIKAGEEVEGVYIEDMAKGPKIKAINN
FT                   IPLGHKIALSNLKQGDTVIKYGRPIGSAIKEIKIGEHVHVHNIRSNRWGKWRKSQ"
     MPHFLIHNKN DNVGVAITDI KAGEEVEGVY IEDMAKGPKI KAINNIPLGH KIALSNLKQG        60
     DTVIKYGRPI GSAIKEIKIG EHVHVHNIRS NRWGKWRKSQ                             100
//

If you have problems or comments...

PBIL Back to PBIL home page