(data stored in ACNUC7421 zone)

EMBL: CP001402.PE466

CP001402.PE466       Location/Qualifiers
FT   CDS             403704..404870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0472"
FT                   /product="D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41102"
FT                   /db_xref="GOA:C4KDX9"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDX9"
FT                   /protein_id="ACR41102.1"
FT                   /translation="MEKKPVIKGYIRENGSVGVRNYVTVIPVDDLSNSAAIGVSKLIRG
FT                   TVAIPHPYGRLQFGKDLDLLFHVLSGTGANPNVAGAIVIGIEENWANKVANKIAETGKP
FT                   VEVFPIEGNGDLRVIEKASRKAKEMVQEASEKQRTEVDLSSLVMSIKCGESDTTSGLAS
FT                   NPATGYAVDKLIDYGATVLFGETSELTGAEDIVASRIPDPVLREKFMKIYKEYVDFIES
FT                   QGVDLLGSQPTEGNIKGGLSTIEEKALGNIQKLGTKPITCVLDYLDPLEKNSSRLCFVN
FT                   TSSAAAEAVTLFAAKGSVLHLFTTGQGNVVGHPIIPVVKISANPKTVATMSEHIDVDVS
FT                   DLLQLKVSLREAGERIFNYTIRVANGRLTSAELLQHNEFSPIKLYISA"
     MEKKPVIKGY IRENGSVGVR NYVTVIPVDD LSNSAAIGVS KLIRGTVAIP HPYGRLQFGK        60
     DLDLLFHVLS GTGANPNVAG AIVIGIEENW ANKVANKIAE TGKPVEVFPI EGNGDLRVIE       120
     KASRKAKEMV QEASEKQRTE VDLSSLVMSI KCGESDTTSG LASNPATGYA VDKLIDYGAT       180
     VLFGETSELT GAEDIVASRI PDPVLREKFM KIYKEYVDFI ESQGVDLLGS QPTEGNIKGG       240
     LSTIEEKALG NIQKLGTKPI TCVLDYLDPL EKNSSRLCFV NTSSAAAEAV TLFAAKGSVL       300
     HLFTTGQGNV VGHPIIPVVK ISANPKTVAT MSEHIDVDVS DLLQLKVSLR EAGERIFNYT       360
     IRVANGRLTS AELLQHNEFS PIKLYISA                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page