(data stored in ACNUC7421 zone)

EMBL: CP001402.PE467

CP001402.PE467       Location/Qualifiers
FT   CDS             404873..406003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0473"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41103"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY0"
FT                   /protein_id="ACR41103.1"
FT                   /translation="MKVKPFSLSIPFNTNPPSDWKDTWDVQLYVKVEDEEDYGWGETLV
FT                   AGSGIINSYLSIINDIVIPVLSKVELTEPTDVRTILEKILFSAGNCGVVSGAISAVEMA
FT                   LWGLKARKSNVELTRVIGGKVRDSVKVYASFPRFGKIDYIIIATRKSIERGFDLVKLHQ
FT                   SPSSVIDAVKAIRENYKEIKIAIDLNSPFDNLDKAKEFVDKVHKYEIEWVEEPLWPPND
FT                   YDLLSKLTEFSPIPIAAGENEYSLYGFKKLIESGITYLQPDIAKIGGVSKFLEILDLAS
FT                   KHKVRVLPHDRPDASPLSLIYTLNLGLVKSQIEMVEYTIADFPNDLFYSLPKFKNGYIY
FT                   PSENPEVIEENIEKYGYKNRLRILHFSDLESKLTRK"
     MKVKPFSLSI PFNTNPPSDW KDTWDVQLYV KVEDEEDYGW GETLVAGSGI INSYLSIIND        60
     IVIPVLSKVE LTEPTDVRTI LEKILFSAGN CGVVSGAISA VEMALWGLKA RKSNVELTRV       120
     IGGKVRDSVK VYASFPRFGK IDYIIIATRK SIERGFDLVK LHQSPSSVID AVKAIRENYK       180
     EIKIAIDLNS PFDNLDKAKE FVDKVHKYEI EWVEEPLWPP NDYDLLSKLT EFSPIPIAAG       240
     ENEYSLYGFK KLIESGITYL QPDIAKIGGV SKFLEILDLA SKHKVRVLPH DRPDASPLSL       300
     IYTLNLGLVK SQIEMVEYTI ADFPNDLFYS LPKFKNGYIY PSENPEVIEE NIEKYGYKNR       360
     LRILHFSDLE SKLTRK                                                       376
//

If you have problems or comments...

PBIL Back to PBIL home page