(data stored in ACNUC7421 zone)

EMBL: CP001402.PE47

CP001402.PE47        Location/Qualifiers
FT   CDS             complement(39904..40770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0047"
FT                   /product="protein of unknown function DUF191"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40683"
FT                   /db_xref="GOA:C4KJG3"
FT                   /db_xref="InterPro:IPR003773"
FT                   /db_xref="InterPro:IPR030869"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG3"
FT                   /protein_id="ACR40683.1"
FT                   /translation="MVTIRVGALADSGDLYPFIPLMEGKVRPEGFNLEFEVIPTVQDIN
FT                   EAVLKKEVDVSVPSAAMYPYIQDDYYILSNAVATAVDGITGMPILAIKEMSENEIKRSR
FT                   LIVHGPNTTAFTLYKLLMGKYGRLVIIRRVLDEIKALGKEGDVLVAVHEIKMMYALKKL
FT                   GINVVRIGSMWDMWKAISNNTPMPMGMVVISKEVGKDFALKFKETYEKSKKYAEKHLDE
FT                   IIPRDVQIMRESQKADLDEEIVRKTIWADIQEYNVPVDEVRRGLEFFFKISEERGILPR
FT                   VKSIDLL"
     MVTIRVGALA DSGDLYPFIP LMEGKVRPEG FNLEFEVIPT VQDINEAVLK KEVDVSVPSA        60
     AMYPYIQDDY YILSNAVATA VDGITGMPIL AIKEMSENEI KRSRLIVHGP NTTAFTLYKL       120
     LMGKYGRLVI IRRVLDEIKA LGKEGDVLVA VHEIKMMYAL KKLGINVVRI GSMWDMWKAI       180
     SNNTPMPMGM VVISKEVGKD FALKFKETYE KSKKYAEKHL DEIIPRDVQI MRESQKADLD       240
     EEIVRKTIWA DIQEYNVPVD EVRRGLEFFF KISEERGILP RVKSIDLL                    288
//

If you have problems or comments...

PBIL Back to PBIL home page