(data stored in ACNUC7421 zone)

EMBL: CP001402.PE473

CP001402.PE473       Location/Qualifiers
FT   CDS             complement(411464..412201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0481"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41109"
FT                   /db_xref="GOA:C4KDY6"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY6"
FT                   /protein_id="ACR41109.1"
FT                   /translation="MKCKIPFVELPNSFPKSDVDVYRVLEEDGKYYIRLELDGKPMYLT
FT                   FSANEIVLHSKELYEMVSREEIDDCSPLGILDEIFYIILYQLGTKRTQLFLEFDNLFDL
FT                   ITSGKIKDSKRIILLRKRILTNYSDSTVIYYVSRRLSKFLSAESIEDVKFNYERAELLV
FT                   TRSGDLYNIYLTEVQNDLNEIIKKLTSISFIFMPITAIASIYAVDYTNVYNTLINWQSL
FT                   IFLSPVLILTVLLVIYLRRIKWL"
     MKCKIPFVEL PNSFPKSDVD VYRVLEEDGK YYIRLELDGK PMYLTFSANE IVLHSKELYE        60
     MVSREEIDDC SPLGILDEIF YIILYQLGTK RTQLFLEFDN LFDLITSGKI KDSKRIILLR       120
     KRILTNYSDS TVIYYVSRRL SKFLSAESIE DVKFNYERAE LLVTRSGDLY NIYLTEVQND       180
     LNEIIKKLTS ISFIFMPITA IASIYAVDYT NVYNTLINWQ SLIFLSPVLI LTVLLVIYLR       240
     RIKWL                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page