(data stored in ACNUC7421 zone)

EMBL: CP001402.PE474

CP001402.PE474       Location/Qualifiers
FT   CDS             complement(412198..412461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2787"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2787"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41110"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDY7"
FT                   /protein_id="ACR41110.1"
FT                   /translation="MYYRGKVEQLLNKIELVIPYDKVRDVAVKYISSFPKSILENQRLF
FT                   YEKVYVPLRDHFIEKVVNRKRVWRISFISNNALYLKLVRVKI"
     MYYRGKVEQL LNKIELVIPY DKVRDVAVKY ISSFPKSILE NQRLFYEKVY VPLRDHFIEK        60
     VVNRKRVWRI SFISNNALYL KLVRVKI                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page