(data stored in ACNUC7421 zone)

EMBL: CP001402.PE477

CP001402.PE477       Location/Qualifiers
FT   CDS             complement(413627..414562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0483"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41113"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ0"
FT                   /protein_id="ACR41113.1"
FT                   /translation="MKKSNAKTIYATSAKYSQITLEHIEQNRIESYTPFFKIDTKIDKW
FT                   EKAIKAVEVIVSQLEKEGVEKSVYLLWSGKGIHVRINENAIPKDFGPLTAAHAIVQYVL
FT                   REVRDEIIKIGDVKVDELIDPKRVFTVPLSPHKELDYVTVCFSPDKLSKFSLDWANPDS
FT                   FIHEERVYERYEKDEAKELIERALMEYKPSHEGVKPKKEETAEGKIVRFQVMDILEAAR
FT                   YYVLYGDLDKAKSFGLNRAIFYAWAKYYGREYVPKGSKTGILPEIKKSEDKISTEVTGE
FT                   SVYQDVKTGYYIIGDKPQIPEDYDKEIKNK"
     MKKSNAKTIY ATSAKYSQIT LEHIEQNRIE SYTPFFKIDT KIDKWEKAIK AVEVIVSQLE        60
     KEGVEKSVYL LWSGKGIHVR INENAIPKDF GPLTAAHAIV QYVLREVRDE IIKIGDVKVD       120
     ELIDPKRVFT VPLSPHKELD YVTVCFSPDK LSKFSLDWAN PDSFIHEERV YERYEKDEAK       180
     ELIERALMEY KPSHEGVKPK KEETAEGKIV RFQVMDILEA ARYYVLYGDL DKAKSFGLNR       240
     AIFYAWAKYY GREYVPKGSK TGILPEIKKS EDKISTEVTG ESVYQDVKTG YYIIGDKPQI       300
     PEDYDKEIKN K                                                            311
//

If you have problems or comments...

PBIL Back to PBIL home page