(data stored in ACNUC7421 zone)

EMBL: CP001402.PE478

CP001402.PE478       Location/Qualifiers
FT   CDS             415252..415989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0484"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41114"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ1"
FT                   /protein_id="ACR41114.1"
FT                   /translation="MKIRVSIISLKGGVGKTTIALNTALYLSKRYKVLYIDKDLLSMGS
FT                   LILGFNGLGFHKAIVEGLGNEQYEYKVNNNLTLFKLYSEPVNEKELHDKMKDIGEKAKK
FT                   AYVDVISKGYDVIIVDYGRIFRTNDPLVYDEYEMFKKNFPDYLIATVGITDAIRNDITN
FT                   VVKYFLDTINGTKAKPLAFVINMVPPISDIQKEIGQMAREISEVVKCDTLIIPFNEKLV
FT                   QYSNIGEVEEMQKLGKLIEGILY"
     MKIRVSIISL KGGVGKTTIA LNTALYLSKR YKVLYIDKDL LSMGSLILGF NGLGFHKAIV        60
     EGLGNEQYEY KVNNNLTLFK LYSEPVNEKE LHDKMKDIGE KAKKAYVDVI SKGYDVIIVD       120
     YGRIFRTNDP LVYDEYEMFK KNFPDYLIAT VGITDAIRND ITNVVKYFLD TINGTKAKPL       180
     AFVINMVPPI SDIQKEIGQM AREISEVVKC DTLIIPFNEK LVQYSNIGEV EEMQKLGKLI       240
     EGILY                                                                   245
//

If you have problems or comments...

PBIL Back to PBIL home page