(data stored in ACNUC7421 zone)

EMBL: CP001402.PE479

CP001402.PE479       Location/Qualifiers
FT   CDS             416017..416292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0485"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41115"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ2"
FT                   /protein_id="ACR41115.1"
FT                   /translation="MLSTLDNQLKGLYYVKGKDFEIYFYDEVNSRLLQVTYTSDKIEER
FT                   EIRSLLKAEEMLRAKELIVITYDIEGEEEREGKKIKLIPLYKFLLT"
     MLSTLDNQLK GLYYVKGKDF EIYFYDEVNS RLLQVTYTSD KIEEREIRSL LKAEEMLRAK        60
     ELIVITYDIE GEEEREGKKI KLIPLYKFLL T                                       91
//

If you have problems or comments...

PBIL Back to PBIL home page