(data stored in ACNUC7421 zone)

EMBL: CP001402.PE48

CP001402.PE48        Location/Qualifiers
FT   CDS             40874..41404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0048"
FT                   /product="protein of unknown function DUF84"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40684"
FT                   /db_xref="GOA:C4KJG4"
FT                   /db_xref="InterPro:IPR002786"
FT                   /db_xref="InterPro:IPR026533"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG4"
FT                   /protein_id="ACR40684.1"
FT                   /translation="MVTIALGSRNPVKINATKEALDVLKLNWDLIGIEVDSGVDKQPFC
FT                   DQTYVGARNRALNVIRVTNADIGLGIEGGVCNVYGKFIANAVVYVITKEGLENFAISSS
FT                   FTLPSSMVSLILQGKELGEASDIIFKTNNSKTKEGAIGLLTNNVINRKMLYVQPIVLAL
FT                   YPIYNTMINNTPF"
     MVTIALGSRN PVKINATKEA LDVLKLNWDL IGIEVDSGVD KQPFCDQTYV GARNRALNVI        60
     RVTNADIGLG IEGGVCNVYG KFIANAVVYV ITKEGLENFA ISSSFTLPSS MVSLILQGKE       120
     LGEASDIIFK TNNSKTKEGA IGLLTNNVIN RKMLYVQPIV LALYPIYNTM INNTPF           176
//

If you have problems or comments...

PBIL Back to PBIL home page