(data stored in ACNUC7421 zone)

EMBL: CP001402.PE481

CP001402.PE481       Location/Qualifiers
FT   CDS             complement(417631..418278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0487"
FT                   /product="CRISPR locus-related DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41117"
FT                   /db_xref="GOA:C4KDZ4"
FT                   /db_xref="InterPro:IPR010163"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ4"
FT                   /protein_id="ACR41117.1"
FT                   /translation="MEGNTLVFGLGFTSEYIVRSITERGRDNIDEVVLMGVFNIDDFRR
FT                   KQADNALNDVKKFLDIINVKYKWKYINVNKDFAEILYEVANELSGKNNLEFYLIGGMRI
FT                   INFVLYYYAMLAKRFGLNVRVFNYTEDMSKKYELPVEIPRRLTDSEAEILKLFKFENSI
FT                   EISIMADRLQKTLSTISKQVSEMEEEGFLECTKTRPKTCRKTILGRVALTFI"
     MEGNTLVFGL GFTSEYIVRS ITERGRDNID EVVLMGVFNI DDFRRKQADN ALNDVKKFLD        60
     IINVKYKWKY INVNKDFAEI LYEVANELSG KNNLEFYLIG GMRIINFVLY YYAMLAKRFG       120
     LNVRVFNYTE DMSKKYELPV EIPRRLTDSE AEILKLFKFE NSIEISIMAD RLQKTLSTIS       180
     KQVSEMEEEG FLECTKTRPK TCRKTILGRV ALTFI                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page