(data stored in ACNUC7421 zone)

EMBL: CP001402.PE483

CP001402.PE483       Location/Qualifiers
FT   CDS             complement(420584..421231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0489"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41119"
FT                   /db_xref="GOA:C4KDZ6"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ6"
FT                   /protein_id="ACR41119.1"
FT                   /translation="MRLIYPILAITIVLVSMFFFFFAHTIYSNLFIKTHSNEERIAQYS
FT                   SGDLHLYLKLNTTKISPGEGVGIIVELFYNGTNPIYVNVSNGSVLLPSPYPCDSQVLVG
FT                   LKVFKGYYTTSNISLAKPLSLYEPGIYFCPLIYAVTQYKLLPLSDQVQLIYNGRVQATL
FT                   NDEISASLNGYWITNSISSLSGGKFTFFQPGVYTVEAVDYFNQTVLGYFIVT"
     MRLIYPILAI TIVLVSMFFF FFAHTIYSNL FIKTHSNEER IAQYSSGDLH LYLKLNTTKI        60
     SPGEGVGIIV ELFYNGTNPI YVNVSNGSVL LPSPYPCDSQ VLVGLKVFKG YYTTSNISLA       120
     KPLSLYEPGI YFCPLIYAVT QYKLLPLSDQ VQLIYNGRVQ ATLNDEISAS LNGYWITNSI       180
     SSLSGGKFTF FQPGVYTVEA VDYFNQTVLG YFIVT                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page