(data stored in ACNUC7421 zone)

EMBL: CP001402.PE484

CP001402.PE484       Location/Qualifiers
FT   CDS             complement(422020..422448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0490"
FT                   /product="HEPN domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41120"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ7"
FT                   /protein_id="ACR41120.1"
FT                   /translation="MNNINLAEGLLQEARIRIAYAELDLKENKDFAFCIRLSQEAVELS
FT                   IKAMLRTLSIEYSKTHDPGKILEANKDRLPEWLRQELNNITYASRWLRAEREPSMYGDE
FT                   IEGIPPNKLYNEDYCVKALEVAKHVFKLAEKLLNEIKK"
     MNNINLAEGL LQEARIRIAY AELDLKENKD FAFCIRLSQE AVELSIKAML RTLSIEYSKT        60
     HDPGKILEAN KDRLPEWLRQ ELNNITYASR WLRAEREPSM YGDEIEGIPP NKLYNEDYCV       120
     KALEVAKHVF KLAEKLLNEI KK                                                142
//

If you have problems or comments...

PBIL Back to PBIL home page