(data stored in ACNUC7421 zone)

EMBL: CP001402.PE486

CP001402.PE486       Location/Qualifiers
FT   CDS             423301..423486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_2791"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_2791"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41122"
FT                   /db_xref="GOA:C4KDZ9"
FT                   /db_xref="UniProtKB/TrEMBL:C4KDZ9"
FT                   /protein_id="ACR41122.1"
FT                   /translation="MFWGLIVSTPVIIVSSMVYGVDGQILTALIWKFLVGPLYILLDVF
FT                   TKREFMLRETRSGGDS"
     MFWGLIVSTP VIIVSSMVYG VDGQILTALI WKFLVGPLYI LLDVFTKREF MLRETRSGGD        60
     S                                                                        61
//

If you have problems or comments...

PBIL Back to PBIL home page