(data stored in ACNUC7421 zone)

EMBL: CP001402.PE489

CP001402.PE489       Location/Qualifiers
FT   CDS             424186..424515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0494"
FT                   /product="DNA polymerase beta domain protein region"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41125"
FT                   /db_xref="GOA:C4KE02"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE02"
FT                   /protein_id="ACR41125.1"
FT                   /translation="MSSWVKRKFEHLRRWREYAEIIAKASEDIDPNSKAYVFGGVAENR
FT                   VTVLSDIDILIVSEVKESFKFKLEVFKRAFDIYGLPFDAPVELHVTYKEGFNGYLKYSK
FT                   VIEIA"
     MSSWVKRKFE HLRRWREYAE IIAKASEDID PNSKAYVFGG VAENRVTVLS DIDILIVSEV        60
     KESFKFKLEV FKRAFDIYGL PFDAPVELHV TYKEGFNGYL KYSKVIEIA                   109
//

If you have problems or comments...

PBIL Back to PBIL home page