(data stored in ACNUC7421 zone)

EMBL: CP001402.PE49

CP001402.PE49        Location/Qualifiers
FT   CDS             complement(41385..42038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0049"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40685"
FT                   /db_xref="UniProtKB/TrEMBL:C4KJG5"
FT                   /protein_id="ACR40685.1"
FT                   /translation="MNPLLLGIDGLSYTSFMKCNPRTLFTLFSSTYRGVVLNKKPQFPQ
FT                   TSWMSVLELKDIKDMSAVNLNNEKPRLLKETNAVAINLPITNPTYGKLSLPYDTSVNAE
FT                   EEINKVTQIVLELIEESPVIASITAIDRLLHKDPTEKCKIYSLVDSAVRKILNKVDDFI
FT                   IFSLYGEPKGENEDGNHEDYGVFLATIPRPSEHDTVKLQEIGELFIKLVKKEYY"
     MNPLLLGIDG LSYTSFMKCN PRTLFTLFSS TYRGVVLNKK PQFPQTSWMS VLELKDIKDM        60
     SAVNLNNEKP RLLKETNAVA INLPITNPTY GKLSLPYDTS VNAEEEINKV TQIVLELIEE       120
     SPVIASITAI DRLLHKDPTE KCKIYSLVDS AVRKILNKVD DFIIFSLYGE PKGENEDGNH       180
     EDYGVFLATI PRPSEHDTVK LQEIGELFIK LVKKEYY                                217
//

If you have problems or comments...

PBIL Back to PBIL home page