(data stored in ACNUC7421 zone)

EMBL: CP001402.PE490

CP001402.PE490       Location/Qualifiers
FT   CDS             424809..426581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0495"
FT                   /product="arabinose ABC transporter, arabinose binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41126"
FT                   /db_xref="GOA:C4KE03"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE03"
FT                   /protein_id="ACR41126.1"
FT                   /translation="MLKKDKKYKAISRAIISIIIVVIIVAIVGGIGAYYLTRAPTSSIT
FT                   STSSVSTSTSSSIPVSTSSSSASQVVDFINTFGSEDPVGLKYLQGNFSIYYPGYIMQSE
FT                   GLPGASGVEVRYVIVNDIEAGKLEGAFWTHAGPEVLSYVELLPNPHDLYNLTPVLQQEG
FT                   LFKNGVRSALLAISYNGTIFSSPMSVDRGEELYFNPKILREYNLPIPTNLSMLIYDTQQ
FT                   LESHGITPWAVSGAEGGYEQLHLWFAIFLSVASQYYGPAGAAKLSNQLMYGVLNLYNTT
FT                   IQKIINETDNIFVQFVSPGAVIPSWQSQSIWSALALVIKGQAAFEAGGNWLAGYATNWY
FT                   NTTTYPAASPYLNWTNISLMAMPFPGTQGIYVIDVDAIAVPALNNPQLQAAVNFVKFVA
FT                   SYNGMKIWTYPRAVSIWDNATDYYKTPIQWYDYQDLLHTAPQDFTWAFADGSLFDDVFY
FT                   YLISQELNLQEQGLSYIPTFNAALLKAENMTFHEWQLAAKDGFGFVGIRGEPFGDYLPP
FT                   WVNPSTYTYNSSYMPLFLIHPPHYLLPYLKELSQGQYKAQKTDTVINTNILPYSTVIPM
FT                   LLYLDVIIKKYNIF"
     MLKKDKKYKA ISRAIISIII VVIIVAIVGG IGAYYLTRAP TSSITSTSSV STSTSSSIPV        60
     STSSSSASQV VDFINTFGSE DPVGLKYLQG NFSIYYPGYI MQSEGLPGAS GVEVRYVIVN       120
     DIEAGKLEGA FWTHAGPEVL SYVELLPNPH DLYNLTPVLQ QEGLFKNGVR SALLAISYNG       180
     TIFSSPMSVD RGEELYFNPK ILREYNLPIP TNLSMLIYDT QQLESHGITP WAVSGAEGGY       240
     EQLHLWFAIF LSVASQYYGP AGAAKLSNQL MYGVLNLYNT TIQKIINETD NIFVQFVSPG       300
     AVIPSWQSQS IWSALALVIK GQAAFEAGGN WLAGYATNWY NTTTYPAASP YLNWTNISLM       360
     AMPFPGTQGI YVIDVDAIAV PALNNPQLQA AVNFVKFVAS YNGMKIWTYP RAVSIWDNAT       420
     DYYKTPIQWY DYQDLLHTAP QDFTWAFADG SLFDDVFYYL ISQELNLQEQ GLSYIPTFNA       480
     ALLKAENMTF HEWQLAAKDG FGFVGIRGEP FGDYLPPWVN PSTYTYNSSY MPLFLIHPPH       540
     YLLPYLKELS QGQYKAQKTD TVINTNILPY STVIPMLLYL DVIIKKYNIF                  590
//

If you have problems or comments...

PBIL Back to PBIL home page