(data stored in ACNUC7421 zone)

EMBL: CP001402.PE491

CP001402.PE491       Location/Qualifiers
FT   CDS             complement(427793..428641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0496"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41127"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE04"
FT                   /protein_id="ACR41127.1"
FT                   /translation="MKTNLNHQNNKRNMNVNKVYLLDQGKISADLAWFLPTPMTEEEMR
FT                   NPKPRSWTDVSVMSAVIEHKDGIILFDTGISEKVKEKWPQIALSVFPVTKFSDENRMEN
FT                   QLRQIGLKPEDIHFIVFSHLHLDHTGNLDLFRSAKPAVIVHEKELKYSLLNVWLNKPVP
FT                   YLLKDLEILREMNVVPMSTDYLELLPGVDLYLFGGHTPGSIMLKVRTQNDNNYIFTGDF
FT                   IHLPDELDFESKGWLLGNAEEYYTRIRLLKALMKLPRTNVIITHDPKLWDKYPKAPKEL
FT                   K"
     MKTNLNHQNN KRNMNVNKVY LLDQGKISAD LAWFLPTPMT EEEMRNPKPR SWTDVSVMSA        60
     VIEHKDGIIL FDTGISEKVK EKWPQIALSV FPVTKFSDEN RMENQLRQIG LKPEDIHFIV       120
     FSHLHLDHTG NLDLFRSAKP AVIVHEKELK YSLLNVWLNK PVPYLLKDLE ILREMNVVPM       180
     STDYLELLPG VDLYLFGGHT PGSIMLKVRT QNDNNYIFTG DFIHLPDELD FESKGWLLGN       240
     AEEYYTRIRL LKALMKLPRT NVIITHDPKL WDKYPKAPKE LK                          282
//

If you have problems or comments...

PBIL Back to PBIL home page