(data stored in ACNUC7421 zone)

EMBL: CP001402.PE492

CP001402.PE492       Location/Qualifiers
FT   CDS             complement(428638..429285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0497"
FT                   /product="Bacterio-opsin activator HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41128"
FT                   /db_xref="InterPro:IPR007050"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE05"
FT                   /protein_id="ACR41128.1"
FT                   /translation="MEKFSVLSIDLFHPDCWTSITDKYEVNVKLLSQSFDNDNFFSSRI
FT                   LILGRDSKGLINEMRASKNVKVIKVYSMDKGAFVADFIYPKRNTISSLLHETNSIVISH
FT                   RIMDGIEKWKIVVNVSSIPKILQSLERTSNLISFKVVKLSELRKLMNKLTDRNMEILKI
FT                   AYERGLFNYPRQCKLTSISNEIGIKQNTLLYHIRKAEKLLLEILLDEYYSLL"
     MEKFSVLSID LFHPDCWTSI TDKYEVNVKL LSQSFDNDNF FSSRILILGR DSKGLINEMR        60
     ASKNVKVIKV YSMDKGAFVA DFIYPKRNTI SSLLHETNSI VISHRIMDGI EKWKIVVNVS       120
     SIPKILQSLE RTSNLISFKV VKLSELRKLM NKLTDRNMEI LKIAYERGLF NYPRQCKLTS       180
     ISNEIGIKQN TLLYHIRKAE KLLLEILLDE YYSLL                                  215
//

If you have problems or comments...

PBIL Back to PBIL home page