(data stored in ACNUC7421 zone)

EMBL: CP001402.PE495

CP001402.PE495       Location/Qualifiers
FT   CDS             432195..432719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41131"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE08"
FT                   /protein_id="ACR41131.1"
FT                   /translation="MPIIVRKVHKKADGSTIWIRVGESPPVIKDGNVIDGGFFIRIGDD
FT                   KSDKIIRLSDQEALDIAYRIIEAYRRHVRIFTKLDELSYEQYKKSKEVVKDEEEDEEEI
FT                   EKIEEKRNLTPDKIEAELIDYLTAEGGETTLDKVREDLGEEYAAYLRTMKNKGIIIEGT
FT                   RVKLGKNFKNT"
     MPIIVRKVHK KADGSTIWIR VGESPPVIKD GNVIDGGFFI RIGDDKSDKI IRLSDQEALD        60
     IAYRIIEAYR RHVRIFTKLD ELSYEQYKKS KEVVKDEEED EEEIEKIEEK RNLTPDKIEA       120
     ELIDYLTAEG GETTLDKVRE DLGEEYAAYL RTMKNKGIII EGTRVKLGKN FKNT             174
//

If you have problems or comments...

PBIL Back to PBIL home page