(data stored in ACNUC7421 zone)

EMBL: CP001402.PE499

CP001402.PE499       Location/Qualifiers
FT   CDS             complement(434372..434875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0504"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41135"
FT                   /db_xref="GOA:C4KE12"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE12"
FT                   /protein_id="ACR41135.1"
FT                   /translation="MAIGKTVLIVGVIILIVGIALFFIGGYLTSSGLIKVINSISTATP
FT                   TTLQPGTSQDLGVPTKLSILLYNTSSGQVLKILQEINGTNQSVPQIAEKGYIIALLSPK
FT                   YDTIMVNNLTTPISVKYVLSQELASSLVNVALYTGLGFFLAIIGVIVLLVGLVLFLRGR
FT                   GKKQ"
     MAIGKTVLIV GVIILIVGIA LFFIGGYLTS SGLIKVINSI STATPTTLQP GTSQDLGVPT        60
     KLSILLYNTS SGQVLKILQE INGTNQSVPQ IAEKGYIIAL LSPKYDTIMV NNLTTPISVK       120
     YVLSQELASS LVNVALYTGL GFFLAIIGVI VLLVGLVLFL RGRGKKQ                     167
//

If you have problems or comments...

PBIL Back to PBIL home page