(data stored in ACNUC7421 zone)

EMBL: CP001402.PE500

CP001402.PE500       Location/Qualifiers
FT   CDS             complement(434917..435846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0505"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41136"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR029461"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE13"
FT                   /protein_id="ACR41136.1"
FT                   /translation="MVFKFKIGFFTDVHGSDYSFKRSLNIAKARKVDFLIVSGGLMAKE
FT                   IMFVEDVGGKYFLNGKKVNLNNLNEDALRSGKYIVVDKKEVIEDIKSDKSKLEKVISEK
FT                   VTEQMSRWVKIADEVFRLERVFWSSAHGDILQLESILKNYGGKPINENIINLEEIQIVS
FT                   LGYGSPIGNSYREIPDSELYIKGKSLLKDADKERLIMNFHMPPLNTKLDNAKVGLRKSH
FT                   VGSKAVLDLITEFQPLISLHGHVHESTSMDKIGETIAINPGSLYQLGDPSIVIFEVHKE
FT                   LKSFGSVSASKYVIKNIEFVSTNPLDVV"
     MVFKFKIGFF TDVHGSDYSF KRSLNIAKAR KVDFLIVSGG LMAKEIMFVE DVGGKYFLNG        60
     KKVNLNNLNE DALRSGKYIV VDKKEVIEDI KSDKSKLEKV ISEKVTEQMS RWVKIADEVF       120
     RLERVFWSSA HGDILQLESI LKNYGGKPIN ENIINLEEIQ IVSLGYGSPI GNSYREIPDS       180
     ELYIKGKSLL KDADKERLIM NFHMPPLNTK LDNAKVGLRK SHVGSKAVLD LITEFQPLIS       240
     LHGHVHESTS MDKIGETIAI NPGSLYQLGD PSIVIFEVHK ELKSFGSVSA SKYVIKNIEF       300
     VSTNPLDVV                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page