(data stored in ACNUC7421 zone)

EMBL: CP001402.PE501

CP001402.PE501       Location/Qualifiers
FT   CDS             complement(435884..435979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41137"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE14"
FT                   /protein_id="ACR41137.1"
FT                   /translation="MSEGKKKQQVDPCFLAWVYLLEVMEKKEKKD"
     MSEGKKKQQV DPCFLAWVYL LEVMEKKEKK D                                       31
//

If you have problems or comments...

PBIL Back to PBIL home page