(data stored in ACNUC7421 zone)

EMBL: CP001402.PE506

CP001402.PE506       Location/Qualifiers
FT   CDS             441575..442060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0511"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41142"
FT                   /db_xref="GOA:C4KE19"
FT                   /db_xref="UniProtKB/TrEMBL:C4KE19"
FT                   /protein_id="ACR41142.1"
FT                   /translation="MNVIFDVLNEIHGFFGALWAGAALLNFLIRPQEKRQFERIGKFFL
FT                   ITSIITIITGIVIFAYIYLAPYQGNLFLVAAILRSSLDIRIRVFLNLVGGAFGLLAFGA
FT                   GIVISNRIRLMTRFKEGDARVLELRKSVSNLSKISLIFLLLSLAMMILAGSIAQVIT"
     MNVIFDVLNE IHGFFGALWA GAALLNFLIR PQEKRQFERI GKFFLITSII TIITGIVIFA        60
     YIYLAPYQGN LFLVAAILRS SLDIRIRVFL NLVGGAFGLL AFGAGIVISN RIRLMTRFKE       120
     GDARVLELRK SVSNLSKISL IFLLLSLAMM ILAGSIAQVI T                           161
//

If you have problems or comments...

PBIL Back to PBIL home page