(data stored in ACNUC7421 zone)

EMBL: CP001402.PE514

CP001402.PE514       Location/Qualifiers
FT   CDS             454298..454585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0519"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41150"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF3"
FT                   /protein_id="ACR41150.1"
FT                   /translation="MKLQVNGNYIYITLWDKQAKKPRRFYLGRKEDFKKLEELFRVARE
FT                   YRITKQEITDYLEYYFDKRINLTKIEYVILSLSLGVELWKLNGNIRMRLE"
     MKLQVNGNYI YITLWDKQAK KPRRFYLGRK EDFKKLEELF RVAREYRITK QEITDYLEYY        60
     FDKRINLTKI EYVILSLSLG VELWKLNGNI RMRLE                                   95
//

If you have problems or comments...

PBIL Back to PBIL home page