(data stored in ACNUC7421 zone)

EMBL: CP001402.PE516

CP001402.PE516       Location/Qualifiers
FT   CDS             455508..456314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0521"
FT                   /product="Protein of unknown function DUF973"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41152"
FT                   /db_xref="GOA:C4KEF5"
FT                   /db_xref="InterPro:IPR009321"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF5"
FT                   /protein_id="ACR41152.1"
FT                   /translation="MESSIQALKNIKTGSLYYFLAIIIALVTEAVIFREKSLANSFFVL
FT                   IFELVVYGILLIGFSRMRTGFFQLSKTINTYIGTTGVNIFIIGIVALLFGAILPILIYI
FT                   GGSLVFIGDVMIGYTIYKIGQRFQVNTEKIAGILVMISITSFIGYIISYFASDEVMRKM
FT                   LQAPREEKLLIVPSDKSIGYGILKSNGDANVVVYSKESSEIISAQIMGYNFQTLQINPK
FT                   TVMAGENRIYIKFALSGVMFVPGNIYNLEILLANNEKLLASLVYEL"
     MESSIQALKN IKTGSLYYFL AIIIALVTEA VIFREKSLAN SFFVLIFELV VYGILLIGFS        60
     RMRTGFFQLS KTINTYIGTT GVNIFIIGIV ALLFGAILPI LIYIGGSLVF IGDVMIGYTI       120
     YKIGQRFQVN TEKIAGILVM ISITSFIGYI ISYFASDEVM RKMLQAPREE KLLIVPSDKS       180
     IGYGILKSNG DANVVVYSKE SSEIISAQIM GYNFQTLQIN PKTVMAGENR IYIKFALSGV       240
     MFVPGNIYNL EILLANNEKL LASLVYEL                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page