(data stored in ACNUC7421 zone)

EMBL: CP001402.PE517

CP001402.PE517       Location/Qualifiers
FT   CDS             456498..456866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0522"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41153"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF6"
FT                   /protein_id="ACR41153.1"
FT                   /translation="MQKDSLPLNGNIYTISVPRQFLYSGTPVIFANSDFGGSVNPSFAL
FT                   EGTYTHLFKLFNIISLWSTGWDGMFINGQWVTYINAVVGHLSATGVSDMATIPSYLVES
FT                   GLTLFHNEFLGVWTNPYA"
     MQKDSLPLNG NIYTISVPRQ FLYSGTPVIF ANSDFGGSVN PSFALEGTYT HLFKLFNIIS        60
     LWSTGWDGMF INGQWVTYIN AVVGHLSATG VSDMATIPSY LVESGLTLFH NEFLGVWTNP       120
     YA                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page