(data stored in ACNUC7421 zone)

EMBL: CP001402.PE519

CP001402.PE519       Location/Qualifiers
FT   CDS             complement(458589..458855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0524"
FT                   /product="zinc finger C2H2-type domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41155"
FT                   /db_xref="GOA:C4KEF8"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEF8"
FT                   /protein_id="ACR41155.1"
FT                   /translation="MQYSAGLDLNLEDKPFIKSFNFLSLNEVGIIGPYVCPLCLMPFSS
FT                   SVSLKQHIRYTEHAKTCPIFKKEFRNTDSTLDHVCKKHNICVS"
     MQYSAGLDLN LEDKPFIKSF NFLSLNEVGI IGPYVCPLCL MPFSSSVSLK QHIRYTEHAK        60
     TCPIFKKEFR NTDSTLDHVC KKHNICVS                                           88
//

If you have problems or comments...

PBIL Back to PBIL home page