(data stored in ACNUC7421 zone)

EMBL: CP001402.PE52

CP001402.PE52        Location/Qualifiers
FT   CDS             43419..44132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0052"
FT                   /product="Protein of unknown function DUF516"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACR40688"
FT                   /db_xref="GOA:C4KJG8"
FT                   /db_xref="InterPro:IPR007508"
FT                   /db_xref="InterPro:IPR018033"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KJG8"
FT                   /protein_id="ACR40688.1"
FT                   /translation="MDIKLVYSTSDPVGLTIKKLGYSFEEIDEDVTDFHYKNGEAIVIF
FT                   SRHESKASIPSLTVHYPGNPSEEVMGGEPKKLGIAYPRLLTSILREIKKIDLDIEKTME
FT                   ATHHGPTYQNVPVIFVEIGSDKTYWTNERIVRTLVDSTLKGIDKVDETDCRDYISGFGG
FT                   PHYSKLFTKLADESCIGHVISKHYVDKLDDKVIIQAIANSVNNINKVVIDSLNLKQRER
FT                   IIAALKSFDIHIQLR"
     MDIKLVYSTS DPVGLTIKKL GYSFEEIDED VTDFHYKNGE AIVIFSRHES KASIPSLTVH        60
     YPGNPSEEVM GGEPKKLGIA YPRLLTSILR EIKKIDLDIE KTMEATHHGP TYQNVPVIFV       120
     EIGSDKTYWT NERIVRTLVD STLKGIDKVD ETDCRDYISG FGGPHYSKLF TKLADESCIG       180
     HVISKHYVDK LDDKVIIQAI ANSVNNINKV VIDSLNLKQR ERIIAALKSF DIHIQLR          237
//

If you have problems or comments...

PBIL Back to PBIL home page