(data stored in ACNUC7421 zone)

EMBL: CP001402.PE521

CP001402.PE521       Location/Qualifiers
FT   CDS             complement(459183..460055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0526"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41157"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG0"
FT                   /protein_id="ACR41157.1"
FT                   /translation="MRKSLLALLTLSLALLSLLITPTMALNSGGSQIPIYLTSVYTSSI
FT                   LQGLGFSFNNSNNWVETNYISITINLPSSPPNSYQINNAYSIIAGLSPYPVSNINIFNN
FT                   LLQAYVELFTSPPYTYPNEIGFVVSYGSTTFYSYTTLYSSFAGTQLTITISYTGNGFYV
FT                   QFSDSNGFSHSVSVSSVNFVPYGALILGSLVPNGNYYYFPIGNMLPNASVNFSYTISSF
FT                   TIQGNPATSVGMATISPQYGTPIYVSSTGWFKWVSGSPTLINPTAYTYTNLARIGGSMQ
FT                   ISYTTSQLY"
     MRKSLLALLT LSLALLSLLI TPTMALNSGG SQIPIYLTSV YTSSILQGLG FSFNNSNNWV        60
     ETNYISITIN LPSSPPNSYQ INNAYSIIAG LSPYPVSNIN IFNNLLQAYV ELFTSPPYTY       120
     PNEIGFVVSY GSTTFYSYTT LYSSFAGTQL TITISYTGNG FYVQFSDSNG FSHSVSVSSV       180
     NFVPYGALIL GSLVPNGNYY YFPIGNMLPN ASVNFSYTIS SFTIQGNPAT SVGMATISPQ       240
     YGTPIYVSST GWFKWVSGSP TLINPTAYTY TNLARIGGSM QISYTTSQLY                  290
//

If you have problems or comments...

PBIL Back to PBIL home page