(data stored in ACNUC7421 zone)

EMBL: CP001402.PE523

CP001402.PE523       Location/Qualifiers
FT   CDS             complement(460501..460836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0528"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41159"
FT                   /db_xref="GOA:C4KEG2"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG2"
FT                   /protein_id="ACR41159.1"
FT                   /translation="MEFLSLLIFVSGIIVAFLTLYFSPDFGRVKPNKRSLSTIFLSIAL
FT                   TGIGLWLYSIDHPTYIAQPYEGSPEGIYFGPSPTIHVPPPWYANLWPFIIAIGLSILII
FT                   PMIRPKN"
     MEFLSLLIFV SGIIVAFLTL YFSPDFGRVK PNKRSLSTIF LSIALTGIGL WLYSIDHPTY        60
     IAQPYEGSPE GIYFGPSPTI HVPPPWYANL WPFIIAIGLS ILIIPMIRPK N                111
//

If you have problems or comments...

PBIL Back to PBIL home page