(data stored in ACNUC7421 zone)

EMBL: CP001402.PE524

CP001402.PE524       Location/Qualifiers
FT   CDS             complement(460870..461166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41160"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG3"
FT                   /protein_id="ACR41160.1"
FT                   /translation="MWINGAPEPINAVAGHSSATGYLGGTAPIPSYYAESGLTLFHNHN
FT                   VFINYWYNPYAWYFSIGTPQDYSAHGLNYVQLSEGQSYNTINGLNYALYWIPP"
     MWINGAPEPI NAVAGHSSAT GYLGGTAPIP SYYAESGLTL FHNHNVFINY WYNPYAWYFS        60
     IGTPQDYSAH GLNYVQLSEG QSYNTINGLN YALYWIPP                                98
//

If you have problems or comments...

PBIL Back to PBIL home page