(data stored in ACNUC7421 zone)

EMBL: CP001402.PE529

CP001402.PE529       Location/Qualifiers
FT   CDS             complement(463460..464368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0534"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41165"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEG8"
FT                   /protein_id="ACR41165.1"
FT                   /translation="MSGKIADEILNNPQLLSALADKIYDKLKDEIVIKKLEETIGNIKA
FT                   LQEEVKRQGEAISSLQNTVNKHTEAITSLQEAVKKQGEAIQSLQEAVKSLQETVNKHTE
FT                   AITSLQEAVKKQGEAIQSLQEAVKSLQETVNKHTEAITSLQEAVKKQGEAIEGLQKAVR
FT                   KLQRAVMKLSVEVGSFTNRAGKGMERTMLKLYKKALELHGVDPKRVVHGMIKDEEGVIE
FT                   KGKVFEVDFYETNDYVYVFEIKNLADKGAYDQIIIRKKLFYTKYKDKKIKIFLVANYVD
FT                   KKVKKKLEEEGVEIIASHIIK"
     MSGKIADEIL NNPQLLSALA DKIYDKLKDE IVIKKLEETI GNIKALQEEV KRQGEAISSL        60
     QNTVNKHTEA ITSLQEAVKK QGEAIQSLQE AVKSLQETVN KHTEAITSLQ EAVKKQGEAI       120
     QSLQEAVKSL QETVNKHTEA ITSLQEAVKK QGEAIEGLQK AVRKLQRAVM KLSVEVGSFT       180
     NRAGKGMERT MLKLYKKALE LHGVDPKRVV HGMIKDEEGV IEKGKVFEVD FYETNDYVYV       240
     FEIKNLADKG AYDQIIIRKK LFYTKYKDKK IKIFLVANYV DKKVKKKLEE EGVEIIASHI       300
     IK                                                                      302
//

If you have problems or comments...

PBIL Back to PBIL home page