(data stored in ACNUC7421 zone)

EMBL: CP001402.PE531

CP001402.PE531       Location/Qualifiers
FT   CDS             complement(467645..468514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0538"
FT                   /product="major intrinsic protein"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41167"
FT                   /db_xref="GOA:C4KEH0"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C4KEH0"
FT                   /protein_id="ACR41167.1"
FT                   /translation="MSVVLKDSLWRYFAEFVGTFILILFGDAAIVASTLTSQPSFGFIM
FT                   VSWGFGIVLAIYAVGPISGAHINPNVTLAFAVTKRIKWVDVIPYIVFQILGAAAATGVL
FT                   LVWWGDVITRIDPPPFLYADIGAAFFTQYPEPGFWPQYWPKSYLPNVSSAGILYSQVNQ
FT                   IFPLWKGAFAEALMTFLLLLIVVAVTDPDSPFYSQSLAPWAIGIGYVMPFLLFEAQLTG
FT                   GMINEARSWGPMLALYLFGYRTGAYNFRGEYFYVYGIPDFIGGILGALFWDHVLKPYLR
FT                   FVKNINKK"
     MSVVLKDSLW RYFAEFVGTF ILILFGDAAI VASTLTSQPS FGFIMVSWGF GIVLAIYAVG        60
     PISGAHINPN VTLAFAVTKR IKWVDVIPYI VFQILGAAAA TGVLLVWWGD VITRIDPPPF       120
     LYADIGAAFF TQYPEPGFWP QYWPKSYLPN VSSAGILYSQ VNQIFPLWKG AFAEALMTFL       180
     LLLIVVAVTD PDSPFYSQSL APWAIGIGYV MPFLLFEAQL TGGMINEARS WGPMLALYLF       240
     GYRTGAYNFR GEYFYVYGIP DFIGGILGAL FWDHVLKPYL RFVKNINKK                   289
//

If you have problems or comments...

PBIL Back to PBIL home page