(data stored in ACNUC7421 zone)

EMBL: CP001402.PE532

CP001402.PE532       Location/Qualifiers
FT   CDS             complement(468515..470020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="M164_0539"
FT                   /product="glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:M164_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACR41168"
FT                   /db_xref="GOA:C4KEH1"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:C4KEH1"
FT                   /protein_id="ACR41168.1"
FT                   /translation="MNTMSHKFVLALDEGTTSARAILFDSDLNIVNIGQYEFPQHYPQP
FT                   GYVEHDPEEIWEAQMLAVKKAISKIDAKQIVAIGITNQRETTVLWDAKSGKPVYNAIVW
FT                   QDRRTSPITDWLKANYFKMIKDKTGLVPDPYFSASKIKWILDNVSNVREKAERGEIKFG
FT                   TIDTYLIWRLTNGKAHVTDYSNASRTMLFNINKLEWDREILELLKIPESILPEVKPSSE
FT                   IYGYSEALGNLIPISGDAGDQQAALFGQVAFNVGEIKATYGTGSFILMNIGNNPIRSEN
FT                   LLTTIAWGLEKNKAKYALEGSIFITGAAVQWFRDGLRAIDVSDEIEPLASSVEDNGGVY
FT                   FVPAFVGLGAPYWDPYARGLIIGITRGTTKAHIARAILESMAYQTRDVIEVMQKEAGIS
FT                   INSLKVDGGAAKDNLLMQFQADILGIKVIRPKVMETTSMGVAMLAGLGVGLWNSLEELR
FT                   NIWKVDKEFIPSMSEEKRRALYSGWKEAVKRAMGWAKVVGGQV"
     MNTMSHKFVL ALDEGTTSAR AILFDSDLNI VNIGQYEFPQ HYPQPGYVEH DPEEIWEAQM        60
     LAVKKAISKI DAKQIVAIGI TNQRETTVLW DAKSGKPVYN AIVWQDRRTS PITDWLKANY       120
     FKMIKDKTGL VPDPYFSASK IKWILDNVSN VREKAERGEI KFGTIDTYLI WRLTNGKAHV       180
     TDYSNASRTM LFNINKLEWD REILELLKIP ESILPEVKPS SEIYGYSEAL GNLIPISGDA       240
     GDQQAALFGQ VAFNVGEIKA TYGTGSFILM NIGNNPIRSE NLLTTIAWGL EKNKAKYALE       300
     GSIFITGAAV QWFRDGLRAI DVSDEIEPLA SSVEDNGGVY FVPAFVGLGA PYWDPYARGL       360
     IIGITRGTTK AHIARAILES MAYQTRDVIE VMQKEAGISI NSLKVDGGAA KDNLLMQFQA       420
     DILGIKVIRP KVMETTSMGV AMLAGLGVGL WNSLEELRNI WKVDKEFIPS MSEEKRRALY       480
     SGWKEAVKRA MGWAKVVGGQ V                                                 501
//

If you have problems or comments...

PBIL Back to PBIL home page